PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s1012181g002
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family HSF
Protein Properties Length: 433aa    MW: 48939 Da    PI: 5.0236
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s1012181g002genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind39.41.6e-121661247
                        HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT CS
        HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkh 47
                        Fl+k+y++++d+++++++sws  ++sf+v+++ efa+++Lpk F++
  PDK_30s1012181g002 16 FLTKTYDMVDDPSTNSIVSWSPGNTSFIVWNPPEFARDLLPKGFRK 61
                        9******************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.101.2E-14960IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467853.17E-201188IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004152.3E-371288IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004473.0E-91660IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene3DG3DSA:1.10.10.106.8E-56188IPR011991Winged helix-turn-helix DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 433 aa     Download sequence    Send to blast
MEGSQGGSGS NSPAPFLTKT YDMVDDPSTN SIVSWSPGNT SFIVWNPPEF ARDLLPKGFR  60
KIDPDQWEFA NEDFARGQRH LLRNIHRRKP IHSHSLHHQG SSGPLAETER HELEEEIERL  120
KHDKLMLISE LQKHTQLQHG MEQKMQTLEE RLHDMEHRQR NLLAFLTQIV QRHGFLSDFV  180
QQSEFLSKKR RLPKTSYFYE DANMEENCVI SQSKSREESN MGSMHAVDIE PFEKMESSLN  240
SLENFFRGVS QASGEDVYYD CALHSLPSGA VLTEMNASSE DTEVNLRSPS PKLHPSSPCL  300
GDMHSSPELT ESTSYAESPA LPLTEIQTDT RIKVSEIDVN SEPAAPEVDS SRERAAGAAA  360
STVPTGVNDV FWEQFLTETP GSSDTQEVQS ERRNTDDRRS EGKMGERGNI WWSRKNVDHL  420
AEKMGHLTSA ETT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008792312.10.0PREDICTED: heat stress transcription factor A-4b-like
SwissprotQ94J161e-140HFA4B_ORYSJ; Heat stress transcription factor A-4b
TrEMBLM0SEY00.0M0SEY0_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P15640_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32963778
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18880.11e-66heat shock transcription factor A4A